GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

dulaglutide   Click here for help

GtoPdb Ligand ID: 7638

Synonyms: GLP-1Fc | LY2189265 | Trulicity®
Approved drug
dulaglutide is an approved drug (EMA & FDA (2014))
Compound class: Peptide
Comment: Dulaglutide is a GLP-1 mimetic. This treatment has the benefit of being long-acting, with in vivo studies showing peptide immunoreactivity is detactable >6 days following administration [2]. Therefore dulaglutide requires administration only once a week [1].
Peptide Sequence Click here for help
HGEGTFTSDVSSYLEEQAAKEFIAWLVKGGGGGGGSGGGGSGGGGSAESKYGPPCPPCPAPEAAGGPSVFLFPPKPKDTL
MISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSS
IEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLT
VDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLG
Chemical Modification
The first 31 amino acids of this peptide are residues 3-37 of human GLP-1 with the following substitutions(relative to GLP-1 numbering): Ala8Gly, Gly22Glu, Arg36Gly. The next 16 amino acids (GGGGGGGSGGGGSG) are a linker sequence. The remaining 228 amino acids are a synthetic human Fc fragment (immunoglobulin G4). Two identical peptide chains form a dimer, linked by inter-monomer disulphide bonds between Cys55-55 and Cys58-58.