GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

abicipar pegol   Click here for help

GtoPdb Ligand ID: 8371

Synonyms: AGN-150998 | MP0112
Compound class: Peptide
Comment: Abicipar pegol is a VEGFA targeting protein conjugate generated using DARPin® technology [1,3]. The INN record for this construct describes it as a 'pegylated composite protein for clinical applications (CPCA)'. The amino acid sequence for the protein component is provided here. Structurally, the conjugate contains glycyl-seryl-ankyrin repeats (3-35, 36-68, 69-101, 102-123) with a short linker (127-134) and a cysteine di-sulphide bond (1-135), conjugated via a maleimide group linker (thioether bond to C135) to a single linear methoxy polyethylene glycol 20 (mPEG20). DARPins are protein therapeutics that are being developed as an alternative to antigen receptors (antibodies).
Peptide Sequence Click here for help
GSDLDKKLLEAARAGQDDEVRILMANGADVNARDSTGWTPLHLAAPWGHPEIVEVLLKNGADVNAADFQGWTPLHLAAAV
GHLEIVEVLLKYGADVNAQDKFGKTAFDISIDNGNEDLAEILQKAAGGGSGGGSC