GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

ularitide   Click here for help

GtoPdb Ligand ID: 8446

Synonyms: ESP-305
Compound class: Peptide
Comment: Ularitide is a synthetic 32 amino acid peptidomimetic of human urodilatin (atrial natriuretic peptide (95-126)).
Peptide Sequence Click here for help
TAPRSLRRSSCFGGRMDRIGAQSGLGCNSFRY
Thr-Ala-Pro-Arg-Ser-Leu-Arg-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Met-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr
Post-translational Modification
Disulphide bond between cysteines 11 and 27.