GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

[125I]Tyr0-CRF (human, rat, mouse)   Click here for help

GtoPdb Ligand ID: 914

Synonyms: [125I]-Tyr0-corticotropin
 Ligand is labelled  Ligand is radioactive
Compound class: Peptide
Click here for help
Peptide Sequence Click here for help
YSEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII
Tyr-Ser-Glu-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Ala-Arg-Ala-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Met-Glu-Ile-Ile-NH2
Chemical Modification
A tyrosine residue is added to the N-terminal of the natural sequence of CRF