GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.
|
Compound class:
Endogenous peptide in human, mouse or rat
Comment: Plays an important role in the regulation of cell proliferation, cell differentiation and cell migration. Required for normal ossification and bone development. Stimulates hepatic and intestinal proliferation.
Species: Human
|
Peptide Sequence ![]() |
|
|
EENVDFRIHVENQTRARDDVSRKQLRLYQLYSRTSGKHIQVLGRRISARGEDGDKYAQLLVETDTFGSQVRIKGKETEFY LCMNRKGKLVGKPDGTSKECVFIEKVLENNYTALMSAKYSGWYVGFTKKGRPRKGPKTRENQQDVHFMKRYPKGQPELQK PFKYTTVTKRSRRIRPTHPA |
|
| Selected 3D Structures | ||
|
||
| Post-translational Modification | |
| Disulphide bond between Cys109 and Cys127. | |