GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

inbakicept   Click here for help

GtoPdb Ligand ID: 11593

Synonyms: 15RalphaSu-Fc
Compound class: Peptide
Comment: Inbakicept is a fusion protein that links the Sushi domain of the IL15 receptor α subunit (amino acids 1-65 of the peptide sequence provided here) with a human IgG1 Fc domain (aa 81-190 Fc CH2 domain, aa 191-297 Fc CH3 domain). It is one of the protein components of the clinical stage IL-15 superagonist complex ALT-803 [1-2]. It forms a dimeric structure that binds nogapendekin alfa.
Peptide Sequence Click here for help
ITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIREPKSCDKTHTCPPCP
APELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLH
QDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENN
YKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK