GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

pegozafermin   Click here for help

GtoPdb Ligand ID: 14215

Compound class: Peptide
Comment: Pegozafermin (BIO89-100; originally from 89bio, now Roche) is a human FGF-21 analogue. It is O-glycosylated and PEGylated to extend circulating half-life, and has amino acid substitution R175>A to increase receptor potency [1,3]. It was designed to mimic the effects of FGF-21/FGFR signalling for clinical benefit in metabolic disorders (insulin resistance, hypertriglyceridemia, fatty liver disease, inflammation-driven fibrotic liver scarring, and obesity) [3].
Click here for help
Peptide Sequence Click here for help
HPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDG
ALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDV
GSSDPLSMVGPTQGASPSYAS
Chemical Modification
Disulfide bridge Cys75-Cys93
O-glycosylation and pegylation @ Thr172: N-(mPEG-OCONHCH2CO)-αNeu-(2->6)-GalNac-Thr172