GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.
|
Compound class:
Peptide
Comment: Pegozafermin (BIO89-100; originally from 89bio, now Roche) is a human FGF-21 analogue. It is O-glycosylated and PEGylated to extend circulating half-life, and has amino acid substitution R175>A to increase receptor potency [1,3]. It was designed to mimic the effects of FGF-21/FGFR signalling for clinical benefit in metabolic disorders (insulin resistance, hypertriglyceridemia, fatty liver disease, inflammation-driven fibrotic liver scarring, and obesity) [3].
Ligand Activity Visualisation ChartsThese are box plot that provide a unique visualisation, summarising all the activity data for a ligand taken from ChEMBL and GtoPdb across multiple targets and species. Click on a plot to see the median, interquartile range, low and high data points. A value of zero indicates that no data are available. A separate chart is created for each target, and where possible the algorithm tries to merge ChEMBL and GtoPdb targets by matching them on name and UniProt accession, for each available species. However, please note that inconsistency in naming of targets may lead to data for the same target being reported across multiple charts. ✖ |
Peptide Sequence ![]() |
|
|
HPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDG ALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDV GSSDPLSMVGPTQGASPSYAS |
|
| Chemical Modification | |
|
Disulfide bridge Cys75-Cys93 O-glycosylation and pegylation @ Thr172: N-(mPEG-OCONHCH2CO)-αNeu-(2->6)-GalNac-Thr172 |
|