GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

navepegritide   Click here for help

GtoPdb Ligand ID: 14293

Synonyms: TransCon CNP
Compound class: Peptide
Comment: Navepegritide (TransCon CNP) is a prodrug of a human C-type natriuretic peptide (CNP) analogue [1]. It comprises CNP(1-38) attached to an inert polyethylene glycol carrier via a cleavable linker [3]. CNP is a validated therapeutic agent for the treatment of patients with achondroplasia (see the approved CNP analogue vosoritide) [2]. Navepegritide is designed to provide sustained hormone release and continuous CNP exposure as a once-weekly therapy that is proposed to counterbalance the overactivated FGFR3 signaling pathway in achondroplasia [1].
Peptide Sequence Click here for help
LQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC
Leu-Gln-Glu-His-Pro-Asn-Ala-Arg-Lys-Tyr-Lys-Gly-Ala-Asn-Lys-Lys-Gly-Leu-Ser-Lys-Gly-Cys-Phe-Gly-Leu-Lys-Leu-Asp-Arg-Ile-Gly-Ser-Met-Ser-Gly-Leu-Gly-Cys
Chemical Modification
Disulfide bridges location Cys22-Cys38; Lys26 (K26) is chemically modified with four O-methylpoly(ethylene glycol) chains via a cleavable linker