GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

peptide YY   Click here for help

GtoPdb Ligand ID: 1515

Abbreviated name: PYY
Synonyms: peptide tyrosine tyrosine
Comment: The mouse, rat and pig sequences are identical. See the post-translational modifications for possible species-differences
Species: Mouse, Rat, Pig
Click here for help
Peptide Sequence Click here for help
YPAKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY
Tyr-Pro-Ala-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Ser-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2
Post-translational Modification
The C-terminal tyrosine is amidated. In the porcine peptide the serine residue at position 13 has been shown to be phosphorylated [1], and this modification is predicted to occur in the rodent orthologues of the peptide