From August 18th 2026, GtoPdb will require users to register to use the website. Please see our blog post for more information.

ShK Toxin   Click here for help

GtoPdb Ligand ID: 2549

Synonyms: potassium channel toxin ShK | Stichodactyla helianthus toxin
Compound class: Peptide
Comment: From Stoichactis helianthus (Carribean sea anemone)
Click here for help

Ligand Activity Visualisation Charts

These are box plot that provide a unique visualisation, summarising all the activity data for a ligand taken from ChEMBL and GtoPdb across multiple targets and species. Click on a plot to see the median, interquartile range, low and high data points. A value of zero indicates that no data are available. A separate chart is created for each target, and where possible the algorithm tries to merge ChEMBL and GtoPdb targets by matching them on name and UniProt accession, for each available species. However, please note that inconsistency in naming of targets may lead to data for the same target being reported across multiple charts.

✖

View interactive charts of activity data across species
Peptide Sequence Click here for help
RSCIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC
Arg-Ser-Cys-Ile-Asp-Thr-Ile-Pro-Lys-Ser-Arg-Cys-Thr-Ala-Phe-Gln-Cys-Lys-His-Ser-Met-Lys-Tyr-Arg-Leu-Ser-Phe-Cys-Arg-Lys-Thr-Cys-Gly-Thr-Cys
Post-translational Modification
Disulphide bond formation between cysteine residues at positions 3 and 35, 12 and 28, and 17 and 32