GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.
|
Compound class:
Endogenous peptide in human, mouse or rat
Species: Mouse
|
Peptide Sequence ![]() |
|
| KAPSGRMSVLKNLQSLDPSHRISDRDYMGWMDF | |
| Lys-Ala-Pro-Ser-Gly-Arg-Met-Ser-Val-Leu-Lys-Asn-Leu-Gln-Ser-Leu-Asp-Pro-Ser-His-Arg-Ile-Ser-Asp-Arg-Asp-Tys-Met-Gly-Trp-Met-Asp-Phe-NH2 | |
| Post-translational Modification | |
| The C-terminal phenylalanine is amidated and the tyrosine residue at position 27 is sulfated, as indicated by Tys which represents Tyr(SO3H). | |