GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

CCK-33   Click here for help

GtoPdb Ligand ID: 3550

Species: Mouse
Peptide Sequence Click here for help
KAPSGRMSVLKNLQSLDPSHRISDRDYMGWMDF
Lys-Ala-Pro-Ser-Gly-Arg-Met-Ser-Val-Leu-Lys-Asn-Leu-Gln-Ser-Leu-Asp-Pro-Ser-His-Arg-Ile-Ser-Asp-Arg-Asp-Tys-Met-Gly-Trp-Met-Asp-Phe-NH2
Post-translational Modification
The C-terminal phenylalanine is amidated and the tyrosine residue at position 27 is sulfated, as indicated by Tys which represents Tyr(SO3H).