GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.
Compound class:
Endogenous peptide in human, mouse or rat
Species: Human
|
Peptide Sequence ![]() |
|
DGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFY |
Selected 3D Structures | ||
|
Post-translational Modification | |
Predicted N-linked glycosylation of asparagine residue at position 3; disulphide bond formation between cysteine resdiues at positions 38 and 51, 46 and 62, and 64 and 73 |