betacellulin   Click here for help

GtoPdb Ligand ID: 4873

Species: Human
Peptide Sequence Click here for help
DGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFY
Selected 3D Structures
PDB Id: 1IP0
Image of ligand 3D structure from RCSB PDB
Post-translational Modification
Predicted N-linked glycosylation of asparagine residue at position 3; disulphide bond formation between cysteine resdiues at positions 38 and 51, 46 and 62, and 64 and 73