GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

FGF-1   Click here for help

GtoPdb Ligand ID: 4923

Synonyms: acidic fibroblast growth factor | beta-endothelial cell growth factor | heparin-binding growth factor 1 (HBGF-1)
Comment: Monomer and homodimer
Species: Human
Peptide Sequence Click here for help
FNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPN
EECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
Selected 3D Structures
PDB Id: 1afc
Image of ligand 3D structure from RCSB PDB