GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.
|
Synonyms: heparin secretory-transforming protein 2 (HST-2) | heparin-binding growth factor 6 (HBGF-6) | HSTF-2
Compound class:
Endogenous peptide in human, mouse or rat
Species: Human
|
Peptide Sequence ![]() |
|
|
SPAGTRANNTLLDSRGWGTLLSRSRAGLAGEIAGVNWESGYLVGIKRQRRLYCNVGIGFHLQVLPDGRISGTHEENPYSL LEISTVERGVVSLFGVRSALFVAMNSKGRLYATPSFQEECKFRETLLPNNYNAYESDLYQGTYIALSKYGRVKRGSKVSP IMTVTHFLPRI |
|
| Post-translational Modification | |
| Predicted N-linked glycosylation of asparagine residue at position 8; predicted disulphide bond formation between cysteine resdiues at positions 53 and 120 | |