GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

FGF-6   Click here for help

GtoPdb Ligand ID: 4927

Synonyms: heparin secretory-transforming protein 2 (HST-2) | heparin-binding growth factor 6 (HBGF-6) | HSTF-2
Species: Human
Peptide Sequence Click here for help
SPAGTRANNTLLDSRGWGTLLSRSRAGLAGEIAGVNWESGYLVGIKRQRRLYCNVGIGFHLQVLPDGRISGTHEENPYSL
LEISTVERGVVSLFGVRSALFVAMNSKGRLYATPSFQEECKFRETLLPNNYNAYESDLYQGTYIALSKYGRVKRGSKVSP
IMTVTHFLPRI
Post-translational Modification
Predicted N-linked glycosylation of asparagine residue at position 8; predicted disulphide bond formation between cysteine resdiues at positions 53 and 120