GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.
|
Synonyms: IFN-alpha-5 | interferon alpha-5 | interferon alpha-61 | interferon alpha-G
Compound class:
Endogenous peptide in human, mouse or rat
Comment: IFN-α5 is a type I IFN.
Species: Human
|
Peptide Sequence ![]() |
|
|
LGCDLPQTHSLSNRRTLMIMAQMGRISPFSCLKDRHDFGFPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTKDSSATWD ETLLDKFYTELYQQLNDLEACMMQEVGVEDTPLMNVDSILTVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSLSANL QERLRRKE |
|
| Post-translational Modification | |
| Predicted disulphide bond formation between cysteine residues at positions 3 and 101, and 31 and 141 | |