GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

IFN-α5   Click here for help

GtoPdb Ligand ID: 4963

Synonyms: IFN-alpha-5 | interferon alpha-5 | interferon alpha-61 | interferon alpha-G
Immunopharmacology Ligand
Comment: IFN-α5 is a type I IFN.
Species: Human
Peptide Sequence Click here for help
LGCDLPQTHSLSNRRTLMIMAQMGRISPFSCLKDRHDFGFPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTKDSSATWD
ETLLDKFYTELYQQLNDLEACMMQEVGVEDTPLMNVDSILTVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSLSANL
QERLRRKE
Post-translational Modification
Predicted disulphide bond formation between cysteine residues at positions 3 and 101, and 31 and 141