GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.
|
Synonyms: interleukin-19 | melanoma differentiation-associated protein-like protein
Compound class:
Endogenous peptide in human, mouse or rat
Comment: IL-19 is an IL-10 related type II cytokine.
Species: Human
|
Peptide Sequence ![]() |
|
|
LRRCLISTDMHHIEESFQEIKRAIQAKDTFPNVTILSTLETLQIIKPLDVCCVTKNLLAFYVDRVFKDHQEPNPKILRKI SSIANSFLYMQKTLRQCQEQRQCHCRQEATNATRVIHDNYDQLEVHAAAIKSLGELDVFLAWINKNHEVMFSA |
|
| Selected 3D Structures | ||
|
||
| Post-translational Modification | |
| Predicted N-linked glycosylation of asparagine residues at positions 32 and 111; disulphide bomd formation between cysteine residues at positions 4 and 97, 51 and 103, and 52 and 105 | |