IL-19

Ligand id: 4984

Name: IL-19

Species: Human

Peptide Sequence
LRRCLISTDMHHIEESFQEIKRAIQAKDTFPNVTILSTLETLQIIKPLDVCCVTKNLLAFYVDRVFKDHQEPNPKILRKI
SSIANSFLYMQKTLRQCQEQRQCHCRQEATNATRVIHDNYDQLEVHAAAIKSLGELDVFLAWINKNHEVMFSA
Selected 3D Structures
PDB Id: 1N1F
Image of ligand 3D structure from RCSB PDB
Post-translational Modification
Predicted N-linked glycosylation of asparagine residues at positions 32 and 111; disulphide bomd formation between cysteine residues at positions 4 and 97, 51 and 103, and 52 and 105