From August 18th 2026, GtoPdb will require users to register to use the website. Please see our blog post for more information.

IL-20   Click here for help

GtoPdb Ligand ID: 4986

Synonyms: cytokine Zcyto10 | interleukin-20
Immunopharmacology Ligand
Comment: IL-20 is an IL-10 related type II cytokine. The IL-20 pathway is a pharmacological target with potential therapeutic benefit for patients wth rheumatoid arthritis [1].
Species: Human
Peptide Sequence Click here for help
LKTLNLGSCVIATNLQEIRNGFSEIRGSVQAKDGNIDIRILRRTESLQDTKPANRCCLLRHLLRLYLDRVFKNYQTPDHY
TLRKISSLANSFLTIKKDLRLCHAHMTCHCGEEAMKKYSQILSHFEKLEPQAAVVKALGELDILLQWMEETE
Post-translational Modification
Predicted disulphide bond formation between cysteine residues at positions 9 and 102, 56 and 108, and 57 and 110