GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

TWEAK   Click here for help

GtoPdb Ligand ID: 5067

Synonyms: Apo-3 ligand (Apo3L) | CD255 | TNF-related weak inducer of apoptosis | Tumor necrosis factor ligand superfamily member 12, membrane form
Comment: TWEAK protein (TNFSF12) is a tumor necrosis factor (TNF) family cytokine that exists in both membrane-bound and secreted forms. It acts via interaction with the TWEAK receptor (encoded by the TNFRSF12A gene), and is a modulator of endothelial cell proliferation and migration, and is therefore an angiogenesis regulator.
Species: Human
Peptide Sequence Click here for help
MAARRSQRRRGRRGEPGTALLVPLALGLGLALACLGLLLAVVSLGSRASLSAQEPAQEELVAEEDQDPSELNPQTEESQD
PAPFLNRLVRPRRSAPKGRKTRARRAIAAHYEVHPRPGQDGAQAGVDGTVSGWEEARINSSSPLRYNRQIGEFIVTRAGL
YYLYCQVHFDEGKAVYLKLDLLVDGVLALRCLEEFSATAASSLGPQLRLCQVSGLLALRPGSSLRIRTLPWAHLKAAPFL
TYFGLFQVH