From August 18th 2026, GtoPdb will require users to register to use the website. Please see our blog post for more information.

adrenomedullin-(11-50) (rat)   Click here for help

GtoPdb Ligand ID: 704

Synonyms: AM (11-50) | rat adrenomedullin (11-50)
Compound class: Peptide
Comment: Synthetic fragment of rat adrenomedullin
Click here for help
Peptide Sequence Click here for help
STGCRFGTCTMQKLAHQIYQFTDKDKDGMAPRNKISPQGY
Ser-Arg-Ser-Thr-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Met-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Gly-Met-Ala-Pro-Arg-Asn-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2