AM-(11-50) (rat)

Ligand id: 704

Name: AM-(11-50) (rat)

Peptide Sequence
STGCRFGTCTMQKLAHQIYQFTDKDKDGMAPRNKISPQGY
Ser-Arg-Ser-Thr-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Met-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Gly-Met-Ala-Pro-Arg-Asn-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2