From August 18th 2026, GtoPdb will require users to register to use the website. Please see our blog post for more information.

CXCL6   Click here for help

GtoPdb Ligand ID: 820

Immunopharmacology Ligand
Comment: Human CXCL6 is most closely related to CXCL5.
Species: Human
Click here for help
Peptide Sequence Click here for help
GPVSAVLTELRCTCLRVTLRVNPKTIGKLQVFPAGPQCSKVEVVASLKNGKQVCLDPEAPFLKKVIQKILDSGNKKN
Gly-Pro-Val-Ser-Ala-Val-Leu-Thr-Glu-Leu-Arg-Cys-Thr-Cys-Leu-Arg-Val-Thr-Leu-Arg-Val-Asn-Pro-Lys-Thr-Ile-Gly-Lys-Leu-Gln-Val-Phe-Pro-Ala-Gly-Pro-Gln-Cys-Ser-Lys-Val-Glu-Val-Val-Ala-Ser-Leu-Lys-Asn-Gly-Lys-Gln-Val-Cys-Leu-Asp-Pro-Glu-Ala-Pro-Phe-Leu-Lys-Lys-Val-Ile-Gln-Lys-Ile-Leu-Asp-Ser-Gly-Asn-Lys-Lys-Asn