GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

GLP-2 analogue 10   Click here for help

GtoPdb Ligand ID: 9896

Immunopharmacology Ligand
Compound class: Peptide
Comment: This GLP-2 analogue (peptide 10 in [3]) was designed to increase the peptide's metabolic stability (and in vivo pharmacokinetic profile) beyond that of the clinically approved DPP4 resistant GLP-2 analogue teduglutide, with the aim of providing sustained therapeutic effects. GLP-2 analogue 10 achieves increased half-life by the incorporation of a covalent Cys-mediated side-chain cross-link (or staple) that stabilises the α-helical conformation of the peptide. The terminal PSSGAPPPS sequence of 10 is the C-terminal extension of exendin-4 which improves the peptide's solubility.
The intestinotrophic effects of GLP-2 (e.g. promotion of intestinal growth, reduced epithelial cell apoptosis and inflammation) has led to the development of GLP-2 analogues for the treatment of GI disorders such as short bowel syndrome, inflammatory bowel diseases and potentially other intestinal insufficiency diseases.
Click here for help
Peptide Sequence Click here for help
HGDGSFSDEMCTILDNLCARDFINWLIQTKITDPSSGAPPPS-NH2
Chemical Modification
Cys residues 11 and 18 are covalently linked by the lipidated cross-linker L3 which contains a cysteine-reactive bis-bromoacetamide moiety [3].