|
Synonyms: Angiocept® | BMS-844203 | BMS844203 | CT-322 | CT322
Compound class:
Peptide or derivative
Comment: Pegdinetanib (BMS-844203) was a clinical lead vascular endothelial growth factor receptor 2 (VEGFR2) inhibitor. It is an engineered, affinity-matured peptide derived from human fibronectin type III (FN3: residues 1424-1516) that binds to VEGFR2 [1,3]. The peptide is conjugated with polyethylene glycol (PEG) to increase its molecular size above the threshold for kidney-mediated clearance, and this effectively extends its circulating half-life [5]. Pegdinetanib was investigated for anti-angiogenic activity and its potential to inhibit vascularisation in tumours [2,4]. Pegdinetanib is an example of a peptide-based therapeutic that has utilised a novel scaffold (FN3) as an alternative to antigen receptors (antibodies).
Note that the PubChem CID for pegdinetanib (86278317) represents only the PEG moiety and not the entire peptide conjugate. 
Ligand Activity Visualisation ChartsThese are box plot that provide a unique visualisation, summarising all the activity data for a ligand taken from ChEMBL and GtoPdb across multiple targets and species. Click on a plot to see the median, interquartile range, low and high data points. A value of zero indicates that no data are available. A separate chart is created for each target, and where possible the algorithm tries to merge ChEMBL and GtoPdb targets by matching them on name and UniProt accession, for each available species. However, please note that inconsistency in naming of targets may lead to data for the same target being reported across multiple charts. ✖ |
Peptide Sequence  |
|
|
GEVVAATPTSLLISWRHPHFPTRYYRITYGETGGNSPVQEFTVPLQPPTATISGLKPGVDYTITVYAVTDGRNGRLLSIP ISINYRTEIDKPCQ |
|
| Chemical Modification | |
| Pegylated on C-terminal cysteine residue. | |
