GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

pegdinetanib   Click here for help

GtoPdb Ligand ID: 10472

Synonyms: Angiocept® | BMS-844203 | BMS844203 | CT-322 | CT322
Compound class: Peptide
Comment: Pegdinetanib (BMS-844203) was a clinical lead vascular endothelial growth factor receptor 2 (VEGFR2) inhibitor. It is an engineered, affinity-matured peptide derived from human fibronectin type III (FN3: residues 1424-1516) that binds to VEGFR2 [1,3]. The peptide is conjugated with polyethylene glycol (PEG) to increase its molecular size above the threshold for kidney-mediated clearance, and this effectively extends its circulating half-life [5]. Pegdinetanib was investigated for anti-angiogenic activity and its potential to inhibit vascularisation in tumours [2,4]. Pegdinetanib is an example of a peptide-based therapeutic that has utilised a novel scaffold (FN3) as an alternative to antigen receptors (antibodies).
Note that the PubChem CID for pegdinetanib (86278317) represents only the PEG moiety and not the entire peptide conjugate.
Click here for help
Peptide Sequence Click here for help
GEVVAATPTSLLISWRHPHFPTRYYRITYGETGGNSPVQEFTVPLQPPTATISGLKPGVDYTITVYAVTDGRNGRLLSIP
ISINYRTEIDKPCQ
Chemical Modification
Pegylated on C-terminal cysteine residue.