tissue factor pathway inhibitor   Click here for help

GtoPdb Ligand ID: 11181

Compound class: Endogenous peptide in human, mouse or rat
Comment: TFPI is a serine protease inhibitor that regulates the tissue factor (TF)-dependent blood coagulation pathway (extrinsic pathway). It inhibits activated factor X (Xa) and VIIa-TF proteases in an autoregulatory loop. Some isoforms are tethered to the cell membrane by expression of a glycosylphosphatidylinositol (GPI) anchor, others isoforms are secreted [1-2]. Inhibition of the TFPI restores hemostasis, which is a mechanism being exploited for therapeutic benefit in inherited bleeding disorders.
Species: Human
Peptide Sequence Click here for help
MIYTMKKVHALWASVCLLLNLAPAPLNADSEEDEEHTIITDTELPPLKLMHSFCAFKADDGPCKAIMKRFFFNIFTRQCE
EFIYGGCEGNQNRFESLEECKKMCTRDNANRIIKTTLQQEKPDFCFLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLG
NMNNFETLEECKNICEDGPNGFQVDNYGTQLNAVNNSLTPQSTKVPSLFEFHGPSWCLTPADRGLCRANENRFYYNSVIG
KCRPFKYSGCGGNENNFTSKQECLRACKKGFIQRISKGGLIKTKRKRKKQRVKIAYEEIFVKNM
Post-translational Modification
1-28 is the signal peptide.