GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

gastric inhibitory polypeptide   Click here for help

GtoPdb Ligand ID: 1126

Abbreviated name: GIP
Synonyms: gastric inhibitory peptide | glucose-dependent insulinotropic polypeptide
Comment: Rat GIP differs from human at residues 18 (Arginine) and 40 (Leucine), and from mouse GIP at residues 30 (Lysine), 34 (Asparagine) and 40 (Leucine).
Species: Rat
Click here for help
Peptide Sequence Click here for help
YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKNDWKHNLTQ
Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-Arg-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Leu-Thr-Gln