ACTH

Ligand id: 1331

Name: ACTH

Species: Mouse, Rat

Peptide Sequence
SYSMEHFRWGKPVGKKRRPVKVYPNVAENESAEAFPLEF
Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Val-Ala-Glu-Asn-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe
Post-translational Modification
None.