GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

agouti-related protein   Click here for help

GtoPdb Ligand ID: 1335

Abbreviated name: AGRP
Synonyms: agouti-related peptide
Species: Human
Click here for help
Peptide Sequence Click here for help
AQMGLAPMEGIRRPDQALLPELPGLGLRAPLKKTTAEQAEEDLLQEAQALAEVLDLQDREPRSSRRCVRLHESCLGQQVP
CCDPCATCYCRFFNAFCYCRKLGTAMNPCSRT
Ala-Gln-Met-Gly-Leu-Ala-Pro-Met-Glu-Gly-Ile-Arg-Arg-Pro-Asp-Gln-Ala-Leu-Leu-Pro-Glu-Leu-Pro-Gly-Leu-Gly-Leu-Arg-Ala-Pro-Leu-Lys-Lys-Thr-Thr-Ala-Glu-Gln-Ala-Glu-Glu-Asp-Leu-Leu-Gln-Glu-Ala-Gln-Ala-Leu-Ala-Glu-Val-Leu-Asp-Leu-Gln-Asp-Arg-Glu-Pro-Arg-Ser-Ser-Arg-Arg-Cys-Val-Arg-Leu-His-Glu-Ser-Cys-Leu-Gly-Gln-Gln-Val-Pro-Cys-Cys-Asp-Pro-Cys-Ala-Thr-Cys-Tyr-Cys-Arg-Phe-Phe-Asn-Ala-Phe-Cys-Tyr-Cys-Arg-Lys-Leu-Gly-Thr-Ala-Met-Asn-Pro-Cys-Ser-Arg-Thr
Post-translational Modification
Disulfide bonds are formed between cysteine residues 67 and 82, 74 and 88, 81 and 99, 85 and 109, 90 and 97.