GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

[Arg19]PTH-(1-34) (human)   Click here for help

GtoPdb Ligand ID: 1792

Synonyms: [Arg19]-PTH 1-34 (human)
Compound class: Peptide
Comment: Synthetic ananlogue of human PTH
Click here for help
Peptide Sequence Click here for help
SVSEIQLMHNLGKHLNSMRRVEWLRKKLQDVHNF
Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Arg-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe
Chemical Modification
Glutamic acid residue at position 19 of the natural sequence is replaced by arginine