GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

[His5,Arg19]PTH-(1-34) (human)   Click here for help

GtoPdb Ligand ID: 1793

Synonyms: [His5,Arg19]-PTH 1-34 (human)
Compound class: Peptide
Comment: Synthetic analogue of human PTH
Click here for help
Peptide Sequence Click here for help
SVSEHQLMHNLGKHLNSMRRVEWLRKKLQDVHNF
Ser-Val-Ser-Glu-His-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Arg-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe
Chemical Modification
Isoleucine residue at position 5 is the natural sequence is replaced by histidine; glutamic acid residue at position 19 is replaced by arginine