pseudechetoxin   Click here for help

GtoPdb Ligand ID: 2354

Compound class: Peptide
Comment: From Pseudechis australis (Mulga snake)
Click here for help
Peptide Sequence Click here for help
SNKKNYQKEIVDKHNALRRSVKPTARNMLQMKWNSRAAQNAKRWANRCTFAHSPPNKRTVGKLRCGENIFMSSQPFPWSG
VVQAWYDEIKNFVYGIGAKPPGSVIGHYTQVVWYKSYLIGCASAKCSSSKYLYVCQYCPAGNIRGSIATPYKSGPPCADC
PSACVNKLCTNPCKRNNDFSNCKSLAKKSKCQTEWIKKKCPASCFCHNKII
Post-translational Modification
Disulphide bond formation between cysteine residues at positions 48 and 126, 65 and 138, 121 and 135, 157 and 164, 160 and 169, 173 and 206, 182 and 200, and 191 and 204