kurtoxin   Click here for help

GtoPdb Ligand ID: 2521

Synonyms: Ktx
Compound class: Peptide
Comment: From Parabuthus transvaalicus (South African fattail scorpion)
Click here for help
Peptide Sequence Click here for help
KIDGYPVDYWNCKRICWYNNKYCNDLCKGLKADSGYCWGWTLSCYCQGLPDNARIKRSGRCRA
Lys-Ile-Asp-Gly-Tyr-Pro-Val-Asp-Tyr-Trp-Asn-Cys-Lys-Arg-Ile-Cys-Trp-Tyr-Asn-Asn-Lys-Tyr-Cys-Asn-Asp-Leu-Cys-Lys-Gly-Leu-Lys-Ala-Asp-Ser-Gly-Tyr-Cys-Trp-Gly-Trp-Thr-Leu-Ser-Cys-Tyr-Cys-Gln-Gly-Leu-Pro-Asp-Asn-Ala-Arg-Ile-Lys-Arg-Ser-Gly-Arg-Cys-Arg-Ala
Post-translational Modification
Disulphide bond formation between cysteine residues at positions 12 and 61, 16 and 37, 23 and 44, and 27 and 46.