PnTx-3-6

Ligand id: 2542

Name: PnTx-3-6

Peptide Sequence
ACIPRGEICTDDCECCGCDNQCYCPPGSSLGIFKCSCAHANKYFCNRKKEKCKKA
Ala-Cys-Ile-Pro-Arg-Gly-Glu-Ile-Cys-Thr-Asp-Asp-Cys-Glu-Cys-Cys-Gly-Cys-Asp-Asn-Gln-Cys-Tyr-Cys-Pro-Pro-Gly-Ser-Ser-Leu-Gly-Ile-Phe-Lys-Cys-Ser-Cys-Ala-His-Ala-Asn-Lys-Tyr-Phe-Cys-Asn-Arg-Lys-Lys-Glu-Lys-Cys-Lys-Lys-Ala
Post-translational Modification
Predicted disulphide bond formation between cysteine residues at positions 2 and 16, 9 and 22, 15 and 37, 24 and 35, and 45 and 52