hongotoxin-1

Ligand id: 2545

Name: hongotoxin-1

Peptide Sequence
TVIDVKCTSPKQCLPPCKAQFGIRAGAKCMNGKCKCYPH
Thr-Val-Ile-Asp-Val-Lys-Cys-Thr-Ser-Pro-Lys-Gln-Cys-Leu-Pro-Pro-Cys-Lys-Ala-Gln-Phe-Gly-Ile-Arg-Ala-Gly-Ala-Lys-Cys-Met-Asn-Gly-Lys-Cys-Lys-Cys-Tyr-Pro-His
Post-translational Modification
Disulphide bond formation between cysteine residues at positions 7 and 29, 13 and 34, and 17 and 36.