BgK

Ligand id: 2551

Name: BgK

Peptide Sequence
VCRDWFKETACRHAKSLGNCRTSQKYRANCAKTCELC
Val-Cys-Arg-Asp-Trp-Phe-Lys-Glu-Thr-Ala-Cys-Arg-His-Ala-Lys-Ser-Leu-Gly-Asn-Cys-Arg-Thr-Ser-Gln-Lys-Tyr-Arg-Ala-Asn-Cys-Ala-Lys-Thr-Cys-Glu-Leu-Cys
Post-translational Modification
Disulphide bond formation between cysteine residues at positions 2 and 37, 11 and 30, and 20 and 34.