noxiustoxin

Ligand id: 2552

Name: noxiustoxin

Peptide Sequence
TIINVKCTSPKQCSKPCKELYGSSAGAKCMNGKCKCYNN
Thr-Ile-Ile-Asn-Val-Lys-Cys-Thr-Ser-Pro-Lys-Gln-Cys-Ser-Lys-Pro-Cys-Lys-Glu-Leu-Tyr-Gly-Ser-Ser-Ala-Gly-Ala-Lys-Cys-Met-Asn-Gly-Lys-Cys-Lys-Cys-Tyr-Asn-Asn-NH2
Post-translational Modification
C-terminal asparagine residue undergoes amidation; disulphide bond formation between cysteine residues at positions 7 and 29, 13 and 34, and 17 and 36.