GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

α-dendrotoxin   Click here for help

GtoPdb Ligand ID: 2563

Synonyms: α-DTX
Compound class: Peptide
Click here for help
Peptide Sequence Click here for help
QPRRKLCILHRNPGRCYDKIPAFYYNQKKKQCERFDWSGCGGNSNRFKTIEECRRTCIG
Gln-Pro-Arg-Arg-Lys-Leu-Cys-Ile-Leu-His-Arg-Asn-Pro-Gly-Arg-Cys-Tyr-Asp-Lys-Ile-Pro-Ala-Phe-Tyr-Tyr-Asn-Gln-Lys-Lys-Lys-Gln-Cys-Glu-Arg-Phe-Asp-Trp-Ser-Gly-Cys-Gly-Gly-Asn-Ser-Asn-Arg-Phe-Lys-Thr-Ile-Glu-Glu-Cys-Arg-Arg-Thr-Cys-Ile-Gly
Post-translational Modification
Residue 1 is pyrrolidone carboxylic acid; disulphide bond formation between cysteine residues at positions 7 and 57, 16 and 40 and 32 and 53