GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

BeKm-1   Click here for help

GtoPdb Ligand ID: 2610

Synonyms: neurotoxin BeKm-1 | potassium channel toxin γ-KTx 2.1
Compound class: Peptide
Comment: From Mesobuthus eupeus (Lesser Asian scorpion)
Click here for help
Peptide Sequence Click here for help
RPTDIKCSESYQCFPVCKSRFGKTNGRCVNGFCDCF
Arg-Pro-Thr-Asp-Ile-Lys-Cys-Ser-Glu-Ser-Tyr-Gln-Cys-Phe-Pro-Val-Cys-Lys-Ser-Arg-Phe-Gly-Lys-Thr-Asn-Gly-Arg-Cys-Val-Asn-Gly-Phe-Cys-Asp-Cys-Phe
Post-translational Modification
Disulphide bond formation between cysteine residues at positions 7 and 28, 13 and 33, and 19 and 35