GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

AFT-II   Click here for help

GtoPdb Ligand ID: 2613

Synonyms: neurotoxin-2 | Toxin AFII | Toxin AFT-II
Compound class: Peptide
Comment: Sea anemone toxin from Anthopleura fuscoviridis.
Click here for help
Peptide Sequence Click here for help
GGVPCLCDSDGPSVRGNTLSGIIWLAGCPSGWHNCKAHGPTIGWCCKQ
Gly-Gly-Val-Pro-Cys-Leu-Cys-Asp-Ser-Asp-Gly-Pro-Ser-Val-Arg-Gly-Asn-Thr-Leu-Ser-Gly-Ile-Ile-Trp-Leu-Ala-Gly-Cys-Pro-Ser-Gly-Trp-His-Asn-Cys-Lys-Ala-His-Gly-Pro-Thr-Ile-Gly-Trp-Cys-Cys-Lys-Gln
Post-translational Modification
Disulphide bond formation between cysteine residues in positions 5 and 45, 7 and 35, and 28 and 46