Bc-III

Ligand id: 2615

Name: Bc-III

Peptide Sequence
GVACRCDSDGPTSRGNTLTGTLWLTGGCPSGWHNCRGSGPFIGYCCKK
Gly-Val-Ala-Cys-Arg-Cys-Asp-Ser-Asp-Gly-Pro-Thr-Ser-Arg-Gly-Asn-Thr-Leu-Thr-Gly-Thr-Leu-Trp-Leu-Thr-Gly-Gly-Cys-Pro-Ser-Gly-Trp-His-Asn-Cys-Arg-Gly-Ser-Gly-Pro-Phe-Ile-Gly-Tyr-Cys-Cys-Lys-Lys
Post-translational Modification
Predicted disulphide bond formation between cysteine residues at positions 4 and 45, 6 and 35, and 28 and 46