GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

β-scorpion toxin Cn2   Click here for help

GtoPdb Ligand ID: 2632

Synonyms: β-mammal toxin Cn2 | Toxin 2 | Toxin II.9.2.2
Compound class: Peptide
Comment: From Centruroides noxius (Mexican scorpion)
Peptide Sequence Click here for help
KEGYLVDKNTGCKYECLKLGDNDYCLRECKQQYGKGAGGYCYAFACWCTHLYEQAIVWPLPNKRCS
Lys-Glu-Gly-Tyr-Leu-Val-Asp-Lys-Asn-Thr-Gly-Cys-Lys-Tyr-Glu-Cys-Leu-Lys-Leu-Gly-Asp-Asn-Asp-Tyr-Cys-Leu-Arg-Glu-Cys-Lys-Gln-Gln-Tyr-Gly-Lys-Gly-Ala-Gly-Gly-Tyr-Cys-Tyr-Ala-Phe-Ala-Cys-Trp-Cys-Thr-His-Leu-Tyr-Glu-Gln-Ala-Ile-Val-Trp-Pro-Leu-Pro-Asn-Lys-Arg-Cys-Ser-NH2
Post-translational Modification
C-terminal serine residue undergoes amidation; disulphide bond formation between cysteine residues at positions 12 and 65, 16 and 41, 25 and 46, and 29 and 48.