Abbreviated name: GLP-2
Synonyms: GLP-2 (1-33)
Compound class:
Endogenous peptide in human, mouse or rat
Comment: Mouse GLP-2(1-33) differs from human at residues 11 (Serine) and 19 (Threonine). The mouse sequence differs to rat at residue 11 (Serine)
Species: Mouse
|
Peptide Sequence | |
HADGSFSDEMSTILDNLATRDFINWLIQTKITD | |
His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Ser-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Thr-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp |
Download 2D Structure | |
Canonical SMILES | Download |
Isomeric SMILES | Download |
InChI standard identifier | Download |
InChI standard key | Download |
Molecular structure representations generated using Open Babel