glucagon-like peptide 1-(7-37)   

GtoPdb Ligand ID: 3544

Synonyms: GLP-1(7-37) | GLP-1-(7-37)
Species: Human, Mouse, Rat
Peptide Sequence
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly