Wnt-5a   

GtoPdb Ligand ID: 3548

Synonyms: protein Wnt-5a
Species: Human
Peptide Sequence
IIGAQPLCSQLAGLSQGQKKLCHLYQDHMQYIGEGAKTGIKECQYQFRHRRWNCSTVDNTSVFGRVMQIGSRETAFTYAV
SAAGVVNAMSRACREGELSTCGCSRAARPKDLPRDWLWGGCGDNIDYGYRFAKEFVDARERERIHAKGSYESARILMNLH
NNEAGRRTVYNLADVACKCHGVSGSCSLKTCWLQLADFRKVGDALKEKYDSAAAMRLNSRGKLVQVNSRFNSPTTQDLVY
IDPSPDYCVRNESTGSLGTQGRLCNKTSEGMDGCELMCCGRGYDQFKTVQTERCHCKFHWCCYVKCKKCTEIVDQFVCK
Post-translational Modification
Predicted N-linked glycosylation of asparagine residues at positions 53, 59, 251 and 265. Cysteine residue at position 43 is predicted to be S-palmitoyl cysteine