Wnt-3a   

GtoPdb Ligand ID: 3549

Synonyms: protein Wnt-3a
Species: Human
Peptide Sequence
SYPIWWSLAVGPQYSSLGSQPILCASIPGLVPKQLRFCRNYVEIMPSVAEGIKIGIQECQHQFRGRRWNCTTVHDSLAIF
GPVLDKATRESAFVHAIASAGVAFAVTRSCAEGTAAICGCSSRHQGSPGKGWKWGGCSEDIEFGGMVSREFADARENRPD
ARSAMNRHNNEAGRQAIASHMHLKCKCHGLSGSCEVKTCWWSQPDFRAIGDFLKDKYDSASEMVVEKHRESRGWVETLRP
RYTYFKVPTERDLVYYEASPNFCEPNPETGSFGTRDRTCNVSSHGIDGCDLLCCGRGHNARAERRREKCRCVFHWCCYVS
CQECTRVYDVHTCK
Post-translational Modification
Lipidation of serine residue at position 209 is (O-palmitoyl serine); predicted lipidation of cysteine residue at position 59 to S-palmitoyl cysteine; predicted N-linked glycosylation of asparagine residues at positions 69 amd 280.