GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

CCK-58   Click here for help

GtoPdb Ligand ID: 3554

Species: Rat
Peptide Sequence Click here for help
AVLRPDSEPRARLGALLARYIQQVRKAPSGRMSVLKNLQGLDPSHRISDRDYMGWMDF
Ala-Val-Leu-Arg-Pro-Asp-Ser-Glu-Pro-Arg-Ala-Arg-Leu-Gly-Ala-Leu-Leu-Ala-Arg-Tyr-Ile-Gln-Gln-Val-Arg-Lys-Ala-Pro-Ser-Gly-Arg-Met-Ser-Val-Leu-Lys-Asn-Leu-Gln-Gly-Leu-Asp-Pro-Ser-His-Arg-Ile-Ser-Asp-Arg-Asp-Tys-Met-Gly-Trp-Met-Asp-Phe-NH2
Post-translational Modification
The C-terminal phenylalanine is amidated and the tyrosine residue at position 52 is sulfated, as indicated by Tys which represents Tyr(SO3H).