CCK-58

Ligand id: 3554

Name: CCK-58

Species: Rat

Peptide Sequence
AVLRPDSEPRARLGALLARYIQQVRKAPSGRMSVLKNLQGLDPSHRISDRDYMGWMDF
Ala-Val-Leu-Arg-Pro-Asp-Ser-Glu-Pro-Arg-Ala-Arg-Leu-Gly-Ala-Leu-Leu-Ala-Arg-Tyr-Ile-Gln-Gln-Val-Arg-Lys-Ala-Pro-Ser-Gly-Arg-Met-Ser-Val-Leu-Lys-Asn-Leu-Gln-Gly-Leu-Asp-Pro-Ser-His-Arg-Ile-Ser-Asp-Arg-Asp-Tys-Met-Gly-Trp-Met-Asp-Phe-NH2
Post-translational Modification
The C-terminal phenylalanine is amidated and the tyrosine residue at position 52 is sulfated, as indicated by Tys which represents Tyr(SO3H).